PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf00030g00005.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family TALE
Protein Properties Length: 558aa    MW: 62158.4 Da    PI: 6.2695
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf00030g00005.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox20.96.3e-074845152354
                               SS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
                  Homeobox  23 rypsaeereeLAkklgLterqVkvWFqNrRak 54 
                               r +s +e++ LA k gLt +qV++WF N R +
  Peinf101Scf00030g00005.1 484 RSVSDAEKQLLAVKSGLTRSQVSNWFINARVR 515
                               678999************************88 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005743.3E-21288431IPR006563POX domain
PfamPF075261.7E-26294430IPR006563POX domain
SMARTSM003890.0025456523IPR001356Homeobox domain
SuperFamilySSF466891.15E-9486528IPR009057Homeodomain-like
CDDcd000863.94E-7487520No hitNo description
Gene3DG3DSA:1.10.10.608.2E-14487525IPR009057Homeodomain-like
PfamPF059203.9E-8487515IPR008422Homeobox KN domain
PROSITE profilePS500719.118487519IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008285Biological Processnegative regulation of cell proliferation
GO:0009640Biological Processphotomorphogenesis
GO:0010073Biological Processmeristem maintenance
GO:0010227Biological Processfloral organ abscission
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0010371Biological Processregulation of gibberellin biosynthetic process
GO:0090470Biological Processshoot organ boundary specification
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 558 aa     Download sequence    Send to blast
MAEPHPFLDE NLLHTASVPI SFSNIVGLNY QNHTMEEQNH IIDGHGIRIP FMLQGESINS  60
SQACQSLPNF PRAIETGAIH DVLPGRNRIK EFSLSTSYPI SNPYAEDQYM EGVPISAVAL  120
ANLLAARNAM LENPENLAVL APLSQSVEGQ KIDGPDYPTM LNPSFGSYRN YEFDGVPEIA  180
GTNAGPTGSQ PFQFTENVNS NTWFSSETAS LSSDSPSGSS SRFSNELSLS LTTSQSAVVC  240
GTTIRNQGSD ISCTGVTNHA FPQRRFDSDL TPCNSRNMSS NFGSNKPVHL SQFLTGSRYL  300
HVMQEILSEI AQLSLQNHNM VGYRGNGTAY GANTSFTLSP DTGRGNAALS SDDLPYGDNR  360
INAQMDCEAK KKHLVALLQV VDDQYNQCLD EIHMVISAFH AVTELDPRIH ARFALQTISS  420
LYKNLRERIS NYILAMGEQF DKGGERGGVE NSFETSFIQK QWALQQLKRK DHQLWRPQRG  480
LPERSVSDAE KQLLAVKSGL TRSQVSNWFI NARVRLWKPM IEEMYAEMNR RKIRTGNEDE  540
ASNRRNHKII ENHIFTMN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006361000.20.0PREDICTED: homeobox protein ATH1
SwissprotP487317e-86ATH1_ARATH; Homeobox protein ATH1
TrEMBLK4CLC20.0K4CLC2_SOLLC; Uncharacterized protein
STRINGSolyc08g065420.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA82612327
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32980.12e-84homeobox gene 1